Інформація призначена тільки для фахівців сфери охорони здоров'я, осіб,
які мають вищу або середню спеціальну медичну освіту.

Підтвердіть, що Ви є фахівцем у сфері охорони здоров'я.

"Child`s Health" Том 12, №5, 2017

Back to issue

Development of the immune response in pneumonia due to Staphylococcus aureus (part 4)

Authors: Абатуров А.Е., Никулина А.А.
ГУ «Днепропетровская медицинская академия МЗ Украины», г. Днепр, Украина

Categories: Pediatrics/Neonatology

Sections: Specialist manual

print version


Summary

У даній статті на підставі літературних джерел проаналізовано ключову роль хемокінів сімейств СС, СХС та антимікробних пептидів в елімінації Staphylococcus aureus. Докладно описані основні механізми антистафілококової активності кателіцидину LL-37 у розвитку імунної відповіді при пневмонії, викликаній Staphylococcus aureus.

В данной статье на основании литературных источников проанализирована ключевая роль хемокинов семейств СС, СХС и антимикробных пептидов в элиминации Staphylococcus aureus. Подробно описаны основные механизмы антистафилококковой активности кателицидина LL-37 в развитии иммунного ответа при пневмонии, вызванной Staphylococcus aureus.

In this article, based on the literature sources, the key role of chemokines of CC, CXS families and antimicrobial peptides in the elimination of Staphylococcus aureus is analyzed. The main mechanisms of the anti-staphylococcal activity of catelicidin LL-37 in the development of the immune response in pneumonia caused by Staphylococcus aureus are described in detail.


Keywords

пневмонія; Staphylococcus aureus; імунна відповідь; хемокіни; антимікробні пептиди; кателіцидини

пневмония; Staphylococcus aureus; иммунный ответ; хемокины; антимикробные пептиды; кателицидины

pneumonia; Staphylococcus aureus; immune response; chemokines; antimicrobial peptides; catelicidins

Хемокины

Хемокины семейства CC
CCR1, CCL3
Экспрессия CCL3 хемокина семейства CC эпителиальными клетками во время стафилококковой инфекции за счет его взаимодействия с клеточным рецептором CCR1 способствует рекрутированию Th1-клеток и, вероятно, альвеолярных макрофагов в очаг поражения [11, 58].
 
CCR2, CCL2
Альвеолоциты при инфицировании бактериями Staphylococcus aureus продуцируют CCL2 [4], основной функцией которого является высвобождение моноцитов из костного мозга и транслокация их в кровеносное русло. Практически двукратное увеличение представительства моноцитов и макрофагов в бронхоальвеолярной жидкости отмечается уже через 4 часа после инфицирования Staphylococcus aureus [15]. Известно, что CCL2 также продуцируется макрофагами, лимфоцитами, базофилами, эпителиальными клетками, эндотелиальными клетками и фибробластами [24, 45].

Хемокины семейства CXC

CXCR1 и CXCR2, CXCL1 и CXCL2
Показано, что развитие стафилококковой инфекции сопровождается повышением продукции хемокинов CXCL1 и CXCL2, участвующих в рекрутинге нейтрофилов [59]. Необходимо отметить, что возбуждение Tlr2 (у мышей) Pam3CSK4 MRSA может ингибировать экспрессию хемокинов CXCL1 и CXCL2 и снижать активность рекрутирования нейтрофилов в очаг поражения легкого [9].
 
IL-8/СХСL8
Влияние факторов вирулентности Staphylococcus aureus, в частности поверхностного протеина A, лейкоцидина Пантона — Валентина, сопровождается высвобождением IL-1 и IL-8/СХСL8 в ткани легкого. Данные цитокины являются основными хемоаттрактантами нейтрофилов [33]. Увеличение количества нейтрофилов в костном мозге (незрелые формы) и периферической крови на 63 и 81 % соответственно происходит в более поздний период заболевания — через 16 часов после инфицирования Staphylococcus aureus [15]. Во время стафилококковой инфекции IL-8/СХСL8 первично продуцируется эпителиоцитами слизистой оболочки респираторного тракта [1]. В последующем основными продуцентами IL-8/СХСL8 становятся нейтрофилы. Бактерии Staphylococcus aureus могут ингибировать продукцию IL-8/СХСL8, способствуя собственному выживанию [64].
Роль хемокинов при стафилококковой пневмонии представлена на рис. 1. 

Антимикробные пептиды

В респираторном тракте бактерицидное действие оказывают многочисленные антимикробные пептиды и протеины, которые отличаются особенностями механизмов индукции их синтеза и действия (табл. 1) [36].
Наиболее функционально значимыми АМП, осуществляющими бактерицидную функцию в респираторном тракте человека, являются лизоцим и дефензины [19, 48], однако бактерии Staphylococcus aureus обладают высокой резистентностью к их бактерицидной активности [2, 26, 30, 31]. В отличие от дефензинов LL-37 обладает выраженной бактерицидной антистафилококковой активностью и синергизмом действия с дефензинами, лактоферрином и лизоцимом [8, 16, 37]. 
 
LL-37
Общая характеристика
Человеческий катионный антимикробный пептид 18 кДа (hCAP18), который кодируется геном CAMP, расположенным на хромосоме 3 (3p21.3), и его N-терминальный активный фрагмент, состоящий из 37 аминокислотных остатков и представляющий собой зрелый пептид LL-37, впервые были обнаружены во вторичных нейтрофильных гранулах [13]. Экспрессия CAMP носит выраженный витамин-D-зависимый характер [46].
Пептид LL-37 ([LL-37, 37 aa]) является единственным известным представителем кателицидинового семейства антимикробных пептидов в организме человека [57]. Его молекула представляет амфифильную α-спиральную третичную структуру и существует в виде мономерных и олигомерных форм, которые находятся в количественном равновесии. Благодаря катионности (+6) и гидрофобности своей молекулы пептид LL-37 взаимодействует с несущей отрицательный заряд стенкой бактерий и в последующем формирует поры. Бактерии погибают в результате истечения содержимого через сформированные поры. Также пептид LL-37 обладает способностью непосредственно взаимодействовать с LPS бактерий [21, 43]. Продуцентами hCAP18/LL-37 в респираторном тракте являются эпителиальные клетки, альвеолярные макрофаги, нейтрофилы, моноциты и макрофаги. Активация TLR2, TLR4 и TLR9 приводит к продукции LL-37. Считают, что основную антибактериальную роль пептид LL-37 играет в раннем периоде инфицирования и практически малоэффективен в поздний период инфекционного процесса [28, 40, 44]. 
 
Бактерицидная и антибиопленочная активность
Пептид LL-37 демонстрирует достаточно выраженную бактерицидную активность по отношению как к золотистому стафилококку, так и к другим патогенным бактериям. Пептид LL-37 под действием сериновых протеаз расщепляется на более мелкие фрагменты, такие как KR-20, КС-30, РК-31, LL-23, КС-27, МР-29 и КС-22, которые также обладают антибактериальной активностью (табл. 2) [57].
Пептид LL-37 в бактерицидных концентрациях присутствует в инфицированных регионах респираторного тракта. Увеличение концентрации LL-37 во время стафилококковой инфекции предшествует повышению уровня α-дефензинов в бронхоальвеолярной жидкости [6].
Также пептид LL-37 и его фрагменты препятствуют формированию биопленок патологическими бактериями (табл. 3).
Пептид LL-37 in vitro ингибирует образование биопленки золотистым стафилококком при значительно более низких концентрациях, чем требуется для ингибирования роста колонии или для индукции гибели бактерий [14, 41].
Также LL-37 обладает противогрибковым, противовирусным действием.
 
Влияние на клетки макроорганизма
Пептид LL-37 оказывает влияние на эпителиоциты, иммуноциты, усиливая процесс элиминации патогена из макроорганизма [17]. 
Продемонстрировано, что пептид LL-37 реализует свое действие, взаимодействуя с G-протеинсвязанными рецепторами (G protein-coupled receptor — GPCR); рецепторами тирозиновых киназ; трансмембранными каналами, TLR [54]. Пептид LL-37 непосредственно усиливает активность экспрессии 29 генов и подавляет транскрипцию 20 генов. Среди активируемых генов высокой чувствительностью к влиянию LL-37 обладают гены, кодирующие хемокины и рецепторы хемокинов. Пептид LL-37 усиливает экспрессию моноцитарного хемоаттрактантного протеина 1 (monocyte chemoattractant protein 1 — MCP-1/CCL2) и TNF-α моноцитами, IL-8/CXCL8 — эпителиальными клетками респираторного тракта человека. Также –LL-37 способствует повышению уровня экспрессии –CXCR-4, CCR2, IL-8RB (табл. 4) и подавляет экспрессию ДНК-репарирующих протеинов и субъединиц потенциалзависимых натриевых каналов (табл. 5) [47].
 
Эффекты взаимодействия LL-37 с рецепторами GPCR 
Продемонстрировано, что пептид LL-37 взаимодействует с GPCR: формилпептидным рецептором 2 (formyl peptide receptor 2 — FPR2), хемокиновым рецептором CXCR2, MrgX2 (MAS related GPR family member X2), пуринергическим рецептором P2Y11 (purinergic receptor P2Y11).
Взаимодействие пептида LL-37 с FPR2 эпителиальных клеток способствует повышению барьерной функции эпителия респираторного тракта [54], инициирует хемотаксис нейтрофилов, моноцитов и Т-лимфоцитов [55]. Пептид LL-37, активируя FPR2, подавляет апоптоз нейтрофилов, вызывает продукцию лейкотриенов B4 (LTB4), генерацию АКМ, индуцирует формирование нейтрофильных внеклеточных ловушек [39]. Возбуждение LL-37 рецептора FPR2 эозинофилов вызывает высвобождение цистеиновых лейкотриенов [49]. 
Пептид LL-37, взаимодействуя с хемокиновым рецептором CXCR2, который представляет собой GPCR, чувствительный к токсину коклюша, способствует рекрутированию нейтрофилов [63]. 
Как β-дефензины человека и вещество Р, пептид LL-37 может выступать в качестве агониста рецептора MrgX2 тучных клеток [60]. Пептид LL-37 активирует тучные клетки и индуцирует высвобождение гистамина [22].
 
Эффекты взаимодействия LL-37 с рецепторами тирозиновых киназ
Пептид LL-37 способствует возбуждению таких рецепторов тирозиновых киназ, как рецептор эпидермального фактора роста (epidermal growth factor receptor — EGFR) и рецептор инсулиноподобного фактора I (insulin-like growth factor 1 receptor — IGF1R) [20], за счет активации ADAM-9, ADAM-10, ADAM-12, ADAM-15, ADAM-17 и ADAM-19 [54]. Активация ADAM способствует высвобождению мембраносвязанных EGF, TGF-α, которые в дальнейшем, связываясь с EGFR, приводят к продукции MUC5AC муцина [62]. Трансактивация –LL-37 рецептора EGFR индуцирует миграцию эпителио–цитов и, таким образом, способствует репарации эпителия, а TGF-α повышает уровень активности воспаления [21]. LL-37-индуцированное возбуждение IGF1R способствует инвазии злокачественных клеток [20].
 
Эффекты взаимодействия LL-37 с трансмембранными каналами
Пептид LL-37 также взаимодействует с человеческим пуринергическим рецептором Р2Х7R, который относится к семейству ионотропных АТФ-зависимых рецепторов и высоко экспрессируется иммуноцитами. Активация Р2Х7R приводит к открытию канала для таких катионов, как кальций, натрий и калий [32]. Возбуждение P2X7R, в том числе и LL-37-индуцированное, сопровождается моноцитарной продукцией IL-1β, IL-2, IL-6, IL-18, TNF-α, CXCL3, образованием активных азотсодержащих метаболитов (ААМ) [3, 5, 27, 35], IL-8/CXCL8 [38], PGE2 [10]. Также LL-37 способствует продукции LTB4 и TXA2 макрофагами через P2X7R [56]. Под влиянием LL-37 усиливается продукция CCL2, рекрутирующего моноциты и Т-клетки [18].
Кроме того, LL-37 предопределяет дифференцировку моноцитов человека в фенотип M1 и способствует продукции ими IL-12p40 [53]. 
Взаимодействие LL-37 с Р2Х7R макрофагов приводит к интернализации комплекса LL-37/Р2Х7R, что способствует клиренсу внутриклеточно расположенных бактерий [50]. 
 
Эффекты взаимодействия LL-37 с рецепторами TLR
Пептид LL-37 изменяет активность возбуждения бактериальными лигандами TLR, модулируя выраженность воспалительного процесса (табл. 6).
Действие пептида LL-37 при стафилококковой пневмонии схематически представлено на рис. 2.
Sae-Hae Kim и соавт. [29] предполагают, что –LL-37, с учетом его непосредственной антибактериальной активности и способности модулировать продукцию провоспалительных цитокинов, является перспективным кандидатом, который может быть положен в основу создания лекарственного средства для лечения септических состояний.
 
Конфликт интересов. Авторы заявляют об отсутствии какого-либо конфликта интересов при подготовке данной статьи.

Bibliography

1. Al Alam D. Impaired interleukin-8 chemokine secretion by staphylococcus aureus-activated epithelium and T-cell chemotaxis in cystic fibrosis / D. Al Alam, G. Deslee, C. Tournois et al. // Am. J. Respir. Cell. Mol. Biol. 2010 Jun; 42(6): 644-50. doi: 10.1165/rcmb.2008-0021OC.
2. Andersson D.I. Mechanisms and consequences of bacterial resistance to antimicrobial peptides / D.I. Andersson, D. Hughes, J.Z. Kubicek-Sutherland et al. // Drug. Resist. Updat. 2016 May; 26: 43-57. doi: 10.1016/j.drup.2016.04.002. 
3. Arulkumaran N., Unwin R.J., Tam F.W.A potential therapeutic role for P2X7 receptor (P2X7R) antagonists in the treatment of inflammatory diseases // Expert Opin. Investig. Drugs. 2011 Jul; 20(7): 897-915. doi: 10.1517 /13543784.2011.578068.
4. Athale J. Nrf2 promotes alveolar mitochondrial bioge–nesis and resolution of lung injury in Staphylococcus aureus pneumonia in mice / J. Athale, A. Ulrich, N.C. MacGarvey et al. // Free Radic. Biol. Med. 2012 Oct 15; 53(8): 1584-94. doi: 10.1016/j.freeradbiomed.2012.08.009.
5. Baudelet D. Involvement of the P2X7 purinergic receptor in inflammation: an update of antagonists series since 2009 and their promi–sing therapeutic potential / D. Baudelet, E. Lipka, R. Millet, A. Ghinet // Curr. Med. Chem. 2015; 22(6): 713-29. doi: 10.2174/0929867322666141212120926.
6. Braff M.H. Staphylococcus aureus exploits cathelicidin antimicrobial peptides produced during early pneumonia to promote staphylokinase-dependent fibrinolysis / M.H. Braff, A.L. Jones, S.J. Skerrett, C.E. Rubens // J. Infect. Dis. 2007 May 1; 195(9): 1365-72. doi: 10.1086/513277.
7. Chen Q.X. Silencing airway epithelial cell-derived hepcidin exa–cerbates sepsis induced acute lung injury / Q.X. Chen, S.W. Song, Q.H. Chen et al. // Crit. Care. 2014 Aug 6; 18(4): 470. doi: 10.1186/s13054-014-0470-8.
8. Chen X. Synergistic effect of antibacterial agents human beta-defensins, cathelicidin LL-37 and lysozyme against Staphylococcus aureus and Escherichia coli / X. Chen, F. Niyonsaba, H. Ushio et al. // J. Dermatol. Sci. 2005 Nov; 40(2): 123-32. doi: 10.1016/j.jdermsci.2005.03.014.
9. Chen Y.G. Control of Methicillin-Resistant Staphylococcus aureus Pneumonia Utilizing TLR2 Agonist Pam3CSK4 / Y.G. Chen, Y. Zhang, L.Q. Deng et al. // PLoS One. 2016 Mar 14; 11(3): e0149233. doi: 10.1371/journal.pone.0149233.
10. Chotjumlong P. Involvement of the P2X7 purinergic receptor and c-Jun N-terminal and extracellular signal-regulated kinases in cyclooxygenase-2 and prostaglandin E2 induction by LL-37 / P. Chotjumlong, J.G. Bolscher, K. Nazmi et al. // J. Innate Immun. 2013; 5(1): 72-83. doi: 10.1159/000342928.
11. Cohen T.S. Staphylococcus aureus α toxin potentiates opportunistic bacterial lung infections / T.S. Cohen, J.J. Hilliard, O. Jones-Nelson et al. // Sci Transl. Med. 2016 Mar 9; 8(329): 329ra31. doi: 10.1126/scitranslmed.aad9922.
12. Coorens M. Interspecies cathelicidin comparison reveals divergence in antimicrobial activity, TLR modulation, chemokine induction and regulation of phagocytosis / M. Coorens, M.R. Scheenstra, E.J. Veldhuizen, H.P. Haagsman // Sci Rep. 2017 Jan 19; 7: 40874. doi: 10.1038/srep40874.
13. Cowland J.B., Johnsen A.H., Borregaard N. hCAP-18, a cathelin/pro-bactenecin-like protein of human neutrophil specific granules // FEBS Lett. 1995 Jul 10; 368(1): 173-6. doi: 10.1016/0014-5793(95)00634-L.
14. Dean S.N., Bishop B.M., van Hoek M.L. Natural and synthetic cathelicidin peptides with anti-microbial and anti-biofilm acti–vity against Staphylococcus aureus // BMC Microbiol. 2011 May 23; 11: 114. doi: 10.1186/1471-2180-11-114.
15. Desouza I.A. Inflammatory mechanisms underlying the rat pulmonary neutrophil influx induced by airway exposure to staphylococcal enterotoxin type A / I.A. Desouza, C.F. Franco-Penteado, E.A. Camargo et al. // Br. J. Pharmacol. 2005 Nov; 146(6): 781-91. doi: 10.1038/sj.bjp.0706393.
16. Dorschner R.A. The mammalian ionic environment dictates microbial susceptibility to antimicrobial defense peptides / R.A. Dorschner, B. Lopez-Garcia, A. Peschel et al. // FASEB J. 2006 Jan; 20(1): 35-42. doi: 10.1096/fj.05-4406com.
17. Fabisiak A., Murawska N., Fichna J. LL-37: Cathelicidin-related antimicrobial peptide with pleiotropic activity // Pharmacol Rep. 2016 Aug; 68(4): 802-8. doi: 10.1016/j.pharep.2016.03.015.
18. Flick-Smith H.C. Assessment of antimicrobial peptide LL-37 as a post-exposure therapy to protect against respiratory tularemia in mice / Flick-Smith H.C., Fox M.A., Hamblin K.A. et al. // Peptides. 2013 May; 43: 96-101. doi: 10.1016/j.peptides.2013.02.024.
19. Ganz T. Antimicrobial polypeptides in host defense of the respiratory tract // J. Clin. Invest. 2002 Mar; 109(6): 693-7. doi: 10.1172/JCI15218.
20. Girnita A. Identification of the cathelicidin peptide LL-37 as agonist for the type I insulin-like growth factor receptor / A. Girnita, H. Zheng, A. Grönberg, L. Girnita, M. Ståhle // Oncogene. 2012 Jan 19; 31(3): 352-65. doi: 10.1038/onc.2011.239.
21. Golec M. Cathelicidin LL-37: LPS-neutralizing, pleiotropic peptide // Ann. Agric. Environ. Med. 2007; 14(1): 1-4. PMID: 17655171.
22. Gupta K., Subramanian H., Ali H. Modulation of host defense peptide-mediated human mast cell activation by LPS // Innate Immun. 2016 Jan; 22(1): 21-30. doi: 10.1177/1753425915610643.
23. Gutsmann T. Interaction between antimicrobial peptides and mycobacteria // Biochim. Biophys. Acta. 2016 May; 1858(5): 1034-43. doi: 10.1016/j.bbamem.2016.01.031.
24. Izykowski N. Organizing pneumonia in mice and men / N. Izykowski, M. Kuehnel, K. Hussein et al. // J. Transl. Med. 2016 Jun 10; 14(1): 169. doi: 10.1186/s12967-016-0933-6.
25. Jacobsen A.S., Jenssen H. Human cathelicidin LL-37 prevents bacterial biofilm formation // Future Med. Chem. 2012 Aug; 4(12): 1587-99. doi: 10.4155/fmc.12.97.
26. Joo H.S., Fu C.I., Otto M. Bacterial strategies of resistance to antimicrobial peptides // Philos. Trans. R. Soc. Lond. B. Biol. Sci. 2016 May 26; 371(1695). pii: 20150292. doi: 10.1098/rstb.2015.0292.
27. Kahlenberg J.M., Kaplan M.J. Little peptide, big effects: the role of LL-37 in inflammation and autoimmune disease // J. Immunol. 2013 Nov 15; 191(10): 4895-901. doi: 10.4049/jimmunol.1302005.
28. Karadottir H. Cyclic mechanical stretch down-regulates cathelicidin antimicrobial peptide expression and activates a pro-inflammatory response in human bronchial epithelial cells / H. Karadottir, N.N. Kulkarni, T. Gudjonsson et al. // Peer J. 2015 Dec 7; 3: e1483. doi: 10.7717/peerj.1483. 
29. Kim S.H., Lee H.Y., Jang Y.S. Expression of the ATP-gated P2X7 Receptor on M Cells and Its Modulating Role in the Mucosal Immune Environment // Immune Netw. 2015 Feb; 15(1): 44-9. doi: 10.4110/in.2015.15.1.44.
30. Kraus D., Peschel A.Staphylococcus aureus evasion of innate antimicrobial defense // Future Microbiol. 2008 Aug; 3(4): 437-51. doi: 10.2217/17460913.3.4.437.
31. Kubicek-Sutherland J.Z. Antimicrobial peptide exposure selects for Staphylococcus aureus resistance to human defence peptides / J.Z. Kubicek-Sutherland, H. Lofton, M. Vestergaard et al. // J. Antimicrob. Chemother. 2017 Jan; 72(1): 115-127. doi: 10.1093/jac/dkw381.
32. Kumagai S. Cathelicidin antimicrobial peptide inhibits fibroblast migration via P2X7 receptor signaling / S. Kumagai, K. Matsui, H. Kawaguchi et al. // Biochem. Biophys. Res. Commun. 2013 Aug 9; 437(4): 609-14. doi: 10.1016/j.bbrc.2013.07.010.
33. Labrousse D. Kineret®/IL-1ra blocks the IL-1/IL-8 inflammatory cascade during recombinant Panton Valentine Leukocidin-triggered pneumonia but not during S. aureus infection / D. Labrousse, M. Perret, D. Hayez et al. // PLoS One. 2014 Jun 6; 9(6): e97546. doi: 10.1371/journal.pone.0097546.
34. Lai H.C. The assessment of host and bacterial proteins in sputum from active pulmonary tuberculosis / H.C. Lai, Y.T. Horng, P.F. Yeh et al. // J. Microbiol. 2016 Nov; 54(11): 761-767. doi: 10.1007/s12275-016-6201-x.
35. Lishko V.K. Identification of Human Cathelicidin Peptide LL-37 as a Ligand for Macrophage Integrin αMβ2 (Mac-1, CD11b /CD18) that Promotes Phagocytosis by Opsonizing Bacteria / V.K. Lishko, B. Moreno, N.P. Podolnikova, T.P. Ugarova // Res. Rep. Biochem. 2016 Jul 7; 2016(6): 39-55. PMID: 27990411.
36. Mahlapuu M. Antimicrobial Peptides: An Emerging Category of Therapeutic Agents / M. Mahlapuu, J. Håkansson, L. Ringstad, C. Björn // Front. Cell. Infect. Microbiol. 2016 Dec 27; 6: 194. doi: 10.3389/fcimb.2016.00194.
37. Midorikawa K. Staphylococcus aureus susceptibility to innate antimicrobial peptides, beta-defensins and CAP18, expressed by human keratinocytes / K. Midorikawa, K. Ouhara, H. Komatsuzawa et al. // Infect. Immun. 2003 Jul; 71(7): 3730-9. doi: 10.1128/IAI.71.7.3730-3739.2003.
38. Montreekachon P. Involvement of P2X(7) purinergic receptor and MEK1/2 in interleukin-8 up-regulation by LL-37 in human gingival fibroblasts / P. Montreekachon, P. Chotjumlong, J.G. Bolscher et al. // J. Periodontal Res. 2011 Jun; 46(3): 327-37. doi: 10.1111/j.1600-0765.2011.01346.x.
39. Neumann A. The antimicrobial peptide LL-37 facilitates the formation of neutrophil extracellular traps / A. Neumann, E.T. Berends, A. Nerlich et al. // Biochem J. 2014 Nov 15; 464(1): 3-11. doi: 10.1042 /BJ20140778.
40. Nijnik A., Hancock R.E. The roles of cathelicidin LL-37 in immune defences and novel clinical applications // Curr. Opin. Hematol. 2009 Jan; 16(1): 41-7.
41. Overhage J. Human host defense peptide LL-37 prevents bacterial biofilm formation / J. Overhage, A. Campisano, M. Bains et al. // Infect Immun. 2008 Sep; 76(9): 4176-82. doi: 10.1128/IAI.00318-08.].
42. Punde T.H. A biologically inspired lung-on-a-chip device for the study of protein-induced lung inflammation / T.H. Punde, W.H. Wu, P.C. Lien et al. // Integr. Biol. (Camb). 2015 Feb; 7(2): 162-9. doi: 10.1039/c4ib00239c.
43. Ravensdale J. Efficacy of Antibacterial Peptides Against Peptide-Resistant MRSA Is Restored by Permeabilization of Bacteria Membranes / J. Ravensdale, Z. Wong, F. O’Brien, K. Gregg // Front. Microbiol. 2016 Nov 8; 7: 1745. doi: 10.3389/fmicb.2016.01745.
44. Rivas-Santiago B. Expression of cathelicidin LL-37 du–ring Mycobacterium tuberculosis infection in human alveolar macrophages, monocytes, neutrophils, and epithelial cells / B. Rivas-San–tiago, R. Hernandez-Pando, C. Carranza et al. // Infect. Immun. 2008 Mar; 76(3): 935-41. doi: 10.1128/IAI.01218-07.
45. Rose C.E. Jr, Sung S.S., Fu S.M. Significant involvement of CCL2 (MCP-1) in inflammatory disorders of the lung // Microcirculation. 2003 Jun; 10(3-4): 273-88. doi: 10.1038/sj.mn.7800193.
46. Schrumpf J.A. Pro-inflammatory Cytokines Impair Vitamin D-induced Host Defense in Cultured Airway Epithelial Cells / J.A. Schrumpf, G.D. Amatngalim, J.B. Veldkamp et al. // Am. J. Respir. Cell. Mol. Biol. 2017 Feb 23. doi: 10.1165/rcmb.2016-0289OC.
47. Scott M.G. The human antimicrobial peptide LL-37 is a multifunctional modulator of innate immune responses / M.G. Scott, D.J. Davidson, M.R. Gold et al. // J. Immunol. 2002 Oct 1; 169(7): 3883-91. doi: 10.4049/jimmunol.169.7.3883.
48. Seiler F. Regulation and function of antimicrobial peptides in immunity and diseases of the lung / F. Seiler, P.M. Lepper, R. Bals, C. Beisswenger // Protein Pept. Lett. 2014 Apr; 21(4): 341-51. doi: 10.2174/09298665113206660100.
49. Sun J. The antimicrobial peptide LL-37 induces synthesis and release of cysteinyl leukotrienes from human eosinophils-implications for asthma / J. Sun, B. Dahlén, B. Agerberth, J.Z. Haeggström // Allergy. 2013 Mar; 68(3): 304-11. doi: 10.1111/all.12087.
50. Tang X. P2X7 Receptor Regulates Internalization of Antimicrobial Peptide LL-37 by Human Macrophages That Promotes Intracellular Pathogen Clearance / X. Tang, D. Basavarajappa, J.Z. Haeggström, M. Wan // J. Immunol. 2015 Aug 1; 195(3): 1191-201. doi: 10.4049/jimmunol.1402845.
51. Tecle T., Tripathi S., Hartshorn K.L. Review: Defensins and cathelicidins in lung immunity // Innate Immun. 2010 Jun; 16(3): 151-9. doi: 10.1177/1753425910365734.
52. Tsou Y.A. Investigation of anti-infection mechanism of lactoferricin and splunc-1 / Y.A. Tsou, H.J. Huang, W.W. Lin, C.Y. Chen // Evid. Based Complement. Alternat. Med. 2014; 2014: 907028. doi: 10.1155/2014/907028.
53. Van der Does A.M. LL-37 directs macrophage differentiation toward macrophages with a proinflammatory signature / A.M. van der Does, H. Beekhuizen, B. Ravensbergen et al. // J. Immunol. 2010 Aug 1; 185(3): 1442-9. doi: 10.4049/jimmunol.1000376.
54. Verjans E.T. Molecular mechanisms of LL-37-induced receptor activation: An overview / E.T. Verjans, S. Zels, W. Luyten et al. // Peptides. 2016 Nov; 85: 16-26. doi: 10.1016/j.peptides.2016.09.002.
55. Wan M. Antimicrobial peptide LL-37 promotes bacterial phagocytosis by human macrophages / M. Wan, van der Does A.M., X. Tang et al. // J. Leukoc Biol. 2014 Jun; 95(6): 971-81. doi: 10.1189/jlb.0513304.
56. Wan M. Cathelicidin LL-37 induces time-resolved release of LTB4 and TXA2 by human macrophages and triggers eicosanoid gene–ration in vivo / M. Wan, O. Soehnlein, X. Tang et al. // FASEB J. 2014 Aug; 28(8): 3456-67. doi: 10.1096/fj.14-251306.
57. Wang G. High-quality 3D structures shine light on antibacterial, anti-biofilm and antiviral activities of human cathelicidin LL-37 and its fragments / G. Wang, B. Mishra, R.F. Epand, R.M. Epand // Biochim. Biophys. Acta. 2014 Sep; 1838(9): 2160-72. doi: 10.1016/j.bbamem.2014.01.016.
58. Wang X.Y. A Multiple Antigenic Peptide Mimicking Peptidoglycan Induced T Cell Responses to Protect Mice from Systemic Infection with Staphylococcus aureus / X.Y. Wang, Z.X. Huang, Y.G. Chen et al. // PLoS One. 2015 Aug 28; 10(8): e0136888. doi: 10.1371/journal.pone.0136888. eCollection 2015.
59. Wolf A.J. Phagosomal degradation increases TLR access to bacterial ligands and enhances macrophage sensitivity to bacteria / A.J. Wolf, A. Arruda, C.N. Reyes et al. // J. Immunol. 2011 Dec 1; 187(11): 6002-10. doi: 10.4049/jimmunol.1100232.
60. Wu H. The Origin, Expression, Function and Future Research Focus of a G Protein-coupled Receptor, Mas-related Gene X2 (MrgX2) / H. Wu, M. Zeng, E.Y. Cho, W. Jiang, O. Sha // Prog. Histochem. Cytochem. 2015 Jul; 50(1-2): 11-7. doi: 10.1016/j.proghi.2015.06.001.
61. Yamaguchi Y., Ouchi Y. Antimicrobial peptide defensin: identification of novel isoforms and the characterization of their physiological roles and their significance in the pathogenesis of diseases // Proc. Jpn. Acad. Ser. B. Phys. Biol. Sci. 2012; 88(4): 152-66. doi: 10.2183/pjab.88.152.
62. Zhang Y. The human Cathelicidin LL-37 induces MUC5AC mucin production by airway epithelial cells via TACE-TGF-α-EGFR pathway / Y. Zhang, M. Zhu, Z. Yang et al. // Exp. Lung. Res. 2014 Sep; 40(7): 333-42. doi: 10.3109/01902148.2014.926434.
63. Zhang Z., Cherryholmes G., Shively J.E. Neutrophil secon–dary necrosis is induced by LL-37 derived from cathelicidin // J. Leukoc. Biol. 2008 Sep; 84(3): 780-8. doi: 10.1189/jlb.0208086.
64. Zurek O.W., Pallister K.B., Voyich J.M. Staphylococcus aureus Inhibits Neutrophil-derived IL-8 to Promote Cell Death // J. Infect. Dis. 2015 Sep 15; 212(6): 934-8. doi: 10.1093/infdis /jiv124.

Back to issue